Product Information
12066-1-PBS targets OTUB2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2703 Product name: Recombinant human OTUB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC009615 Sequence: MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFK Predict reactive species |
| Full Name | OTU domain, ubiquitin aldehyde binding 2 |
| Calculated Molecular Weight | 234 aa, 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC009615 |
| Gene Symbol | OTUB2 |
| Gene ID (NCBI) | 78990 |
| RRID | AB_3085388 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96DC9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
OTUB2, also known as C14orf137, belongs to the OTU family. OTUB2 is a functional cysteine protease with deubiquitinase activity. OTUB2 mediates the deubiquitination of substrate proteins, and the targets of substrate proteins can be diversified. Therefore, OTUB2 has a wide range of biological roles, including protecting against virus-induced activation of interferon regulatory factor 3 (IRF3) and NF-κB, promoting beta cell survival in human pancreatic islets, and supporting the DNA repair pathway (PMID: 30662561, 35309903). OTUB2 is widely expressed, with high expression levels in the brain. OTUB2 has 2 isoforms with molecular weights of 9 kDa and 27 kDa.
