OTUB2 Polyclonal antibody

• 

  WB analysis using 12066-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12066-1-AP (OTUB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 12066-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using OTUB2 antibody (12066-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

OTUB2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12066-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Otubain-2, OTU2, OTU domain-containing ubiquitin aldehyde-binding protein 2, OTB2, EC:3.4.19.12

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below

Product Information

12066-1-AP targets OTUB2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2703

  Product name: Recombinant human OTUB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC009615

  Sequence: MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFK

• Full Name: OTU domain, ubiquitin aldehyde binding 2
• Calculated Molecular Weight: 234 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC009615
• Gene Symbol: OTUB2
• Gene ID (NCBI): 78990
• RRID: AB_3085388
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DC9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OTUB2, also known as C14orf137, belongs to the OTU family. OTUB2 is a functional cysteine protease with deubiquitinase activity. OTUB2 mediates the deubiquitination of substrate proteins, and the targets of substrate proteins can be diversified. Therefore, OTUB2 has a wide range of biological roles, including protecting against virus-induced activation of interferon regulatory factor 3 (IRF3) and NF-κB, promoting beta cell survival in human pancreatic islets, and supporting the DNA repair pathway (PMID: 30662561, 35309903). OTUB2 is widely expressed, with high expression levels in the brain. OTUB2 has 2 isoforms with molecular weights of 9 kDa and 27 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; Microtubule architecture connects AMOT stability to YAP/TAZ mechanotransduction and Hippo signalling; Authors - Giada Vanni
human	WB	Acta Pharm Sin B; USP51/GRP78/ABCB1 axis confers chemoresistance through decreasing doxorubicin accumulation in triple-negative breast cancer cells; Authors - Yang Ou
human	WB,IF	Aging (Albany NY); The deubiquitinating enzymes-related signature predicts the prognosis and immunotherapy response in breast cancer; Authors - Youyuan Deng ; KD Validated