• Featured Product
  • KD/KO Validated

OTX2 Polyclonal antibody

OTX2 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 13497-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, FC (Intra), IP, CoIP, ChIP, ELISA

Homeobox protein OTX2, MCOPS5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inY79 cells, mouse retina tissue, rat retina tissue
Positive IP detected inY79 cells
Positive IHC detected inmouse eye tissue, rat eye tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13497-1-AP targets OTX2 in WB, IHC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4323

Product name: Recombinant human OTX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-297 aa of BC032579

Sequence: MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Predict reactive species
Full Name orthodenticle homeobox 2
Calculated Molecular Weight 297 aa, 32 kDa
Observed Molecular Weight 31-35 kDa
GenBank Accession NumberBC032579
Gene Symbol OTX2
Gene ID (NCBI) 5015
RRIDAB_2157176
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP32243
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The orthodenticle homeobox 2, encoded by OTX2 gene, is a key transcription factor in developmental processes. In particular, it is required for the early specification of the brain and the embryonic development of sensory organs, including the, pineal gland, pituitary gland, inner part of the ear, eyes, and optic nerve. In later stages, it is important for maintaining intact retina and brain function. In addition, it acts as a transcriptional repressor and a gatekeeper of myogenic and neuronal differentiation in medulloblastoma cells. OTX2 binds to the MyoD1 core enhancer through its homeobox domain and the remarkable repressor activity exhibited by the homeobox domain renders OTX2 transcriptionally repressive

Protocols

Product Specific Protocols
FC protocol for OTX2 antibody 13497-1-APDownload protocol
IHC protocol for OTX2 antibody 13497-1-APDownload protocol
IP protocol for OTX2 antibody 13497-1-APDownload protocol
WB protocol for OTX2 antibody 13497-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

Unified rhombic lip origins of group 3 and group 4 medulloblastoma

Authors - Kyle S. Smith
mouse

Nature

Reversing a model of Parkinson's disease with in situ converted nigral neurons.

Authors - Hao Qian
mouseWB

Signal Transduct Target Ther

MDIG-mediated H3K9me3 demethylation upregulates Myc by activating OTX2 and facilitates liver regeneration

Authors - Jinpeng Du
  • KD Validated
mouseChIP

Science

Early life stress confers lifelong stress susceptibility in mice via ventral tegmental area OTX2.

Authors - Catherine J Peña
humanchip

Cancer Cell

Atypical Teratoid/Rhabdoid Tumors Are Comprised of Three Epigenetic Subgroups with Distinct Enhancer Landscapes.

Authors - Pascal D Johann
human

Cell Stem Cell

Generation of human pineal gland organoids with melatonin production for disease modeling

Authors - Ferdi Ridvan Kiral

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Alicia (Verified Customer) (10-06-2025)

Cortical organoid staining

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Cortical organoid
FH

David (Verified Customer) (02-21-2022)

This antibody works very well for immunofluorescence on human brain.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1 to 200
  • Cell Tissue Type: Human brain
OTX2 Antibody Immunofluorescence validation (1 to 200 dilution) in Human brain (Cat no:13497-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...