• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated OTX2 Polyclonal antibody

OTX2 Polyclonal Antibody for WB, FC (Intra)

Cat No. CL488-13497

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

MCOPS5, Homeobox protein OTX2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inY79 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13497 targets OTX2 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4323

Product name: Recombinant human OTX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-297 aa of BC032579

Sequence: MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Predict reactive species
Full Name orthodenticle homeobox 2
Calculated Molecular Weight 297 aa, 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC032579
Gene Symbol OTX2
Gene ID (NCBI) 5015
RRIDAB_3083942
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP32243
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The orthodenticle homeobox 2, encoded by OTX2 gene, is a key transcription factor in developmental processes. In particular, it is required for the early specification of the brain and the embryonic development of sensory organs, including the, pineal gland, pituitary gland, inner part of the ear, eyes, and optic nerve. In later stages, it is important for maintaining intact retina and brain function. In addition, it acts as a transcriptional repressor and a gatekeeper of myogenic and neuronal differentiation in medulloblastoma cells. OTX2 binds to the MyoD1 core enhancer through its homeobox domain and the remarkable repressor activity exhibited by the homeobox domain renders OTX2 transcriptionally repressive

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 OTX2 antibody CL488-13497Download protocol
WB protocol for CL Plus 488 OTX2 antibody CL488-13497Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...