Oxytocin-neurophysin 1 Polyclonal antibody, PBS Only

• 

  IP experiment of mouse pituitary gland using 18041-1-AP (same clone as 18041-1-PBS)

  IP result of anti-OXT (IP:18041-1-AP, 4ug; Detection:18041-1-AP 1:300) with mouse pituitary gland tissue lysate 1440 ug. This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

Oxytocin-neurophysin 1 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 18041-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IP, Indirect ELISA

Synonyms

OXT, Neurophysin 1, Ocytocin Neurophysin 1, Oxytocin, Oxytocin neurophysin 1

---

Product Information

18041-1-PBS targets Oxytocin-neurophysin 1 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12672

  Product name: Recombinant human OXT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-125 aa of BC101841

  Sequence: ACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

• Full Name: oxytocin, prepropeptide
• Calculated Molecular Weight: 125 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC101841
• Gene Symbol: OXT
• Gene ID (NCBI): 5020
• RRID: AB_2918056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01178
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Oxytocin (OXT) is a neuropeptide involved in social-approach behaviors in humans and others mammals (PMID: 27325757). OXT is located on chromosome 20p13 and codes for a precursor protein that is synthetized to produce oxytocin and neurophysin I, and neurophysin I is the carrier protein for oxytocin (PMID: 1486803, PMID: 18566739). Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR) (PMID: 18174156).