Oxytocin-neurophysin 1 Polyclonal antibody, PBS Only

• 

  IP experiment of mouse pituitary gland using 18041-1-AP (same clone as 18041-1-PBS)

  IP result of anti-OXT (IP:18041-1-AP, 4ug; Detection:18041-1-AP 1:300) with mouse pituitary gland tissue lysate 1440 ug. This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pituitary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 18041-1-AP (same clone as 18041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18041-1-PBS in a different storage buffer formulation.

Oxytocin-neurophysin 1 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 18041-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IP, Indirect ELISA

Synonyms

OXT, Neurophysin 1, Ocytocin Neurophysin 1, Oxytocin, Oxytocin neurophysin 1

---

Product Information

18041-1-PBS targets Oxytocin-neurophysin 1 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12672

  Product name: Recombinant human OXT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-125 aa of BC101841

  Sequence: ACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

• Full Name: oxytocin, prepropeptide
• Calculated Molecular Weight: 125 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC101841
• Gene Symbol: OXT
• Gene ID (NCBI): 5020
• RRID: AB_2918056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01178
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Oxytocin-neurophysin 1, also called the oxytocin/neurophysin I prepropeptide, is produced in the hypothalamus as a single, inactive precursor that contains two parts: the nonapeptide hormone oxytocin and its carrier protein neurophysin I. After synthesis in magnocellular neurons of the supra-optic and paraventricular nuclei, the precursor is packaged into neurosecretory vesicles and transported down the axon to the posterior pituitary (neurohypophysis). During this axonal transport the precursor is proteolytically cleaved, generating mature oxytocin and its tightly bound neurophysin I; the complex is stored in nerve terminals and secreted into the systemic circulation upon appropriate stimulation.