Oxytocin-neurophysin 1 Polyclonal antibody

• 

  IP experiment of mouse pituitary gland using 18041-1-AP

  IP result of anti-OXT (IP:18041-1-AP, 4ug; Detection:18041-1-AP 1:300) with mouse pituitary gland tissue lysate 1440 ug.

• 

  IHC staining of human pituitary using 18041-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary using 18041-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 18041-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 18041-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 18041-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 18041-1-AP (OXT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Oxytocin-neurophysin 1 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 18041-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF, IP, ELISA

Synonyms

OXT, Neurophysin 1, Ocytocin Neurophysin 1, Oxytocin, Oxytocin neurophysin 1

---

Tested Applications

• Positive IP detected in: mouse pituitary gland tissue
• Positive IHC detected in: human pituitary tissue, mouse ovary tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

18041-1-AP targets Oxytocin-neurophysin 1 in IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12672

  Product name: Recombinant human OXT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-125 aa of BC101841

  Sequence: ACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

• Full Name: oxytocin, prepropeptide
• Calculated Molecular Weight: 125 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC101841
• Gene Symbol: OXT
• Gene ID (NCBI): 5020
• RRID: AB_2918056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01178
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Oxytocin-neurophysin 1, also called the oxytocin/neurophysin I prepropeptide, is produced in the hypothalamus as a single, inactive precursor that contains two parts: the nonapeptide hormone oxytocin and its carrier protein neurophysin I. After synthesis in magnocellular neurons of the supra-optic and paraventricular nuclei, the precursor is packaged into neurosecretory vesicles and transported down the axon to the posterior pituitary (neurohypophysis). During this axonal transport the precursor is proteolytically cleaved, generating mature oxytocin and its tightly bound neurophysin I; the complex is stored in nerve terminals and secreted into the systemic circulation upon appropriate stimulation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Front Endocrinol (Lausanne); Targeted deletion of the pancreatic β-cell oxytocin receptor and its effects on metabolic regulation and β-cell health; Authors - Armando J Mendez