Product Information
81373-8-PBS targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species |
| Full Name | cyclin-dependent kinase inhibitor 2A |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC021998 |
| Gene Symbol | CDKN2A |
| Gene ID (NCBI) | 1029 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42771 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988).











