Tested Applications
Positive WB detected in | pig brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, mouse brain tissue, mouse cerebellum tissue, rabbit brain tissue |
Positive IHC detected in | mouse brain tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | rat brain tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
67654-1-Ig targets P2RY1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Reactivity | human, mouse, rat, pig, rabbit |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species |
Full Name | purinergic receptor P2Y, G-protein coupled, 1 |
Calculated Molecular Weight | 373 aa, 42 kDa |
Observed Molecular Weight | 55 kDa |
GenBank Accession Number | BC074785 |
Gene Symbol | P2RY1 |
Gene ID (NCBI) | 5028 |
RRID | AB_2882853 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P47900 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for P2RY1 antibody 67654-1-Ig | Download protocol |
IHC protocol for P2RY1 antibody 67654-1-Ig | Download protocol |
IF protocol for P2RY1 antibody 67654-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci China Life Sci Inflammatory macrophages exacerbate neutrophil-driven joint damage through ADP/P2Y1 signaling in rheumatoid arthritis. | ||
Oncol Lett New prognostic factors and scoring system for patients with acute myeloid leukemia. | ||
Neuroscience Purinergic Astrocyte Signaling Driven by TNF-α After Cannabidiol Administration Restores Normal Synaptic Remodeling Following Traumatic Brain Injury | ||
Nat Commun Astrocytic neuroligin 3 regulates social memory and synaptic plasticity through adenosine signaling in male mice |