• Featured Product
  • KD/KO Validated

P53 Monoclonal antibody, PBS Only (Capture/Detector)

P53 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 60283-2-PBS
Clone No.6C4B6

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

TP53, 6C4B6, Antigen NY-CO-13, tumor protein p53, Tumor suppressor p53

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60283-2-PBS targets P53 as part of a matched antibody pair:

MP50182-1: 67826-1-PBS capture and 60283-2-PBS detection (validated in Cytometric bead array)

MP50184-1: 60283-2-PBS capture and 67900-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0698

Product name: Recombinant human P53 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-232 aa of BC003596

Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI

Predict reactive species
Full Name tumor protein p53
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC003596
Gene Symbol P53
Gene ID (NCBI) 7157
RRIDAB_2881401
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04637
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

1.       What is p53?

P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.

2.       FAQs and p53

a.       I fail to detect p53 by western blotting

Basal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.

b.      I fail to detect p53 in some cell lines by western blotting

Various p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.

c.       I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different size

p53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight.


Loading...
||
New chat

Able

正在加载,请稍候...