PACSIN1 Monoclonal antibody, PBS Only

PACSIN1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 68115-1-PBS
Clone No.1B7B4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

1B7B4, KIAA1379, SDPI, Syndapin-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68115-1-PBS targets PACSIN1 in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4102

Product name: Recombinant human PACSIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 243-389 aa of BC040228

Sequence: VFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVR

Predict reactive species
Full Name protein kinase C and casein kinase substrate in neurons 1
Calculated Molecular Weight 444 aa, 51 kDa
Observed Molecular Weight 48-51 kDa
GenBank Accession NumberBC040228
Gene Symbol PACSIN1
Gene ID (NCBI) 29993
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BY11
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PACSIN1 (also known as syndapin-1) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family. In mammals, the PACSIN family is comprised of three members, PACSIN1, PACSIN2, and PACSIN3 (PMID: 34990060). PACSIN1 is expressed mainly in neurons, whereas PACSIN2 is ubiquitously expressed in all tissues, and PACSIN3 is expressed mainly in skeletal muscle and the heart (PMID: 23668323). All of these three members contain an N-terminal F-BAR domain and a C-terminal SH3 domain. PACSIN1 plays a role in endocytosis and endosomal recycling. Meanwhile, it has a role in actin remodeling and microtubule nucleation and also plays a particular role in membrane shaping and reconstruction (PMID: 23035120; 34422904). PACSIN1 is involved in neuromorphogenesis and the regulation of the nervous system, and the inappropriate expression of PACSIN1 has been associated with some neurological diseases, including schizophrenia, Alzheimer's disease, and Huntington's disease (PMID: 34990060).

Loading...
||
New chat

Able

正在加载,请稍候...