PAR1/Thrombin Receptor Polyclonal antibody, PBS Only

• 

  WB analysis using 26366-1-AP (same clone as 26366-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26366-1-AP (PAR1/Thrombin Receptor antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26366-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 26366-1-AP (same clone as 26366-1-PBS)

  WB result of F2R antibody (26366-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PAR1/Thrombin Receptor transfected K-562 cells. This data was developed using the same antibody clone with 26366-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 26366-1-AP (same clone as 26366-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26366-1-AP (F2R antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26366-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 26366-1-AP (same clone as 26366-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26366-1-AP (PAR1/Thrombin Receptor Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26366-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 26366-1-AP (same clone as 26366-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26366-1-AP (PAR1/Thrombin Receptor Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26366-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PAR1/Thrombin Receptor Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26366-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

PAR1, Thrombin receptor, CF2R, F2R, HTR

---

Product Information

26366-1-PBS targets PAR1/Thrombin Receptor in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24378

  Product name: Recombinant human F2R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-102 aa of BC051909

  Sequence: LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

• Full Name: coagulation factor II (thrombin) receptor
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 70 kDa, 47 kDa
• GenBank Accession Number: BC051909
• Gene Symbol: F2R
• Gene ID (NCBI): 2149
• RRID: AB_2880492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25116
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protease-activated receptor-1 (PAR1) is a G protein coupled receptor.PAR1 has a greater affinity for thrombin and mediates rapid Ca2+ mobilization and platelet activation. PAR1 has a calculated molecular weight of 47 kDa, but can be detected as 70 kDa after posttranslational modification.(PMID: 26822533)