Tested Applications
| Positive WB detected in | HEK-293 cells, mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
Product Information
21754-1-AP targets PDE4C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16130 Product name: Recombinant human PDE4C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-91 aa of BC109067 Sequence: EYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAK Predict reactive species |
| Full Name | phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) |
| Calculated Molecular Weight | 712 aa, 80 kDa |
| Observed Molecular Weight | ~70 kDa |
| GenBank Accession Number | BC109067 |
| Gene Symbol | PDE4C |
| Gene ID (NCBI) | 5143 |
| RRID | AB_10860265 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08493 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDE4C(cAMP-specific 3,5-cyclic phosphodiesterase 4C) is also named as DPDE1 and belongs to the PDE4 subfamily, which play a key role in lung inflammation and hyperresponsiveness. PDE4C promotes the hydrolysis of cAMP, and PKD2, functioning as a Ca2+ entry channel, may mediate local accumulation of Ca2+ that inhibits the activity of Ca2+-sensitive ADCY5(PMID:21670265). The three isoforms(84,75, and 64 kDa) of PDE4C have been detected in cytosolic, microsomal, and nuclear (PMID:21784969).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PDE4C antibody 21754-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
JCI Insight Inhibition of phosphodiesterase 4D suppresses mTORC1 signaling and pancreatic cancer growth | ||
Mol Metab Inhibition of prolyl hydroxylases increases hepatic insulin and decreases glucagon sensitivity by an HIF-2α-dependent mechanism. | ||
Biochem Pharmacol DC591017, a phosphodiesterase-4 (PDE4) inhibitor with robust anti-inflammation through regulating PKA-CREB signaling. | ||
Am J Physiol Renal Physiol Inhibition of PDE4/PDE4B improves renal function and ameliorates inflammation in cisplatin-induced acute kidney injury. | ||
J Cell Mol Med Analysis of the effects of M2 macrophage-derived PDE4C on the prognosis, metastasis and immunotherapy benefit of osteosarcoma | ||
Atherosclerosis A novel protein encoded by circLARP1B promotes the proliferation and migration of vascular smooth muscle cells by suppressing cAMP signaling |



