Tested Applications
Positive WB detected in | mouse eye tissue, human brain tissue, rat eye tissue |
Positive IHC detected in | mouse eye tissue, human colon cancer tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF detected in | retinal tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF) | IF : 1:50-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
21200-1-AP targets PDE6A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15562 Product name: Recombinant human PDE6A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC035909 Sequence: MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ Predict reactive species |
Full Name | phosphodiesterase 6A, cGMP-specific, rod, alpha |
Calculated Molecular Weight | 860 aa, 100 kDa |
Observed Molecular Weight | 100-110 kDa |
GenBank Accession Number | BC035909 |
Gene Symbol | PDE6A |
Gene ID (NCBI) | 5145 |
RRID | AB_10733345 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P16499 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDE6A(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha) is also named as GMP-PDE alpha, PDE V-B1, PDEA and belongs to the cyclic nucleotide phosphodiesterase family. PDE6A contains an open reading frame capable of coding for a polypeptide of 859 amino acids and about 100 kDa. It is a subunit of a key phototransduction enzyme which participates in processes of transmission and amplification of the visual signal. The expression of PDE6 alpha in retina is essential for normal expression of PDE6 beta and PDE6 gama.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PDE6A antibody 21200-1-AP | Download protocol |
IHC protocol for PDE6A antibody 21200-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Proc Natl Acad Sci U S A Accumulation of non-outer segment proteins in the outer segment underlies photoreceptor degeneration in Bardet-Biedl syndrome. | ||
J Biol Chem The myosin-tail homology domain of centrosomal protein 290 is essential for protein confinement between the inner and outer segments in photoreceptors. | ||
Dev Biol Luteinizing hormone signaling phosphorylates and activates the cyclic GMP phosphodiesterase PDE5 in mouse ovarian follicles, contributing an additional component to the hormonally induced decrease in cyclic GMP that reinitiates meiosis. | ||
Exp Eye Res Characterization of lncRNA and mRNA profiles in ciliary body in experimental myopia |