PDE6G/H Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDE6G/H Polyclonal antibody (18151-1-AP)

PDE6G/H Polyclonal Antibody for WB, IP, ELISA

Cat No. 18151-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

GMP PDE gamma, PDE6H, RCD3

• 

  WB analysis of mouse eye using 18151-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 18151-1-AP (PDE6H Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse eye using 18151-1-AP

  IP result of anti-PDE6G/H (IP:18151-1-AP, 4ug; Detection:18151-1-AP 1:300) with mouse eye tissue lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDE6G/H in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse eye tissue, rat retina tissue
• Positive IP detected in: mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18151-1-AP targets PDE6G/H in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12847

  Product name: Recombinant human PDE6H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC093738

  Sequence: MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII

• Full Name: phosphodiesterase 6H, cGMP-specific, cone, gamma
• Calculated Molecular Weight: 83 aa, 9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC093738
• Gene Symbol: PDE6H
• Gene ID (NCBI): 5149
• RRID: AB_2878509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13956
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PDE6G/H Polyclonal antibody (Cat# 18151-1-AP) has 4 total citations. These appear in Communications Biology, Experimental Eye Research, Research Square, and bioRxiv. The research fields center on ophthalmology and retinal biology, specifically AAV gene therapy for blue cone monochromacy and electroacupuncture effects on retinal cells in myopic guinea pigs. Applications cited include IHC, IF, and WB.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Commun Biol; Molecular mechanisms limiting the AAV gene therapy treatment window in mouse models of blue cone monochromacy.; Authors - Brooke A. Brothers
	WB	Exp Eye Res; Unveiling the impact of electroacupuncture on retinal cells in myopic guinea pigs via single-cell sequencing.; Authors - Zhanglong Li
mouse	IHC	bioRxiv; Molecular Mechanisms Limiting the Therapeutic Window of AAV Gene Therapy in Mouse Models of Blue Cone Monochromacy; Authors - Brooke A Brothers
mouse	IF	Res Sq; Molecular Mechanisms Limiting the Therapeutic Window of AAV Gene Therapy in Mouse Models of Blue Cone Monochromacy; Authors - Wen-Tao Deng