PDE6G/H Polyclonal antibody

• 

  WB analysis of mouse eye using 18151-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 18151-1-AP (PDE6H Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse eye using 18151-1-AP

  IP result of anti-PDE6G/H (IP:18151-1-AP, 4ug; Detection:18151-1-AP 1:300) with mouse eye tissue lysate 4000 ug.

PDE6G/H Polyclonal Antibody for WB, IP, ELISA

Cat No. 18151-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

GMP PDE gamma, PDE6H, RCD3

---

Tested Applications

• Positive WB detected in: mouse eye tissue, rat retina tissue
• Positive IP detected in: mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

18151-1-AP targets PDE6G/H in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12847

  Product name: Recombinant human PDE6H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC093738

  Sequence: MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII

• Full Name: phosphodiesterase 6H, cGMP-specific, cone, gamma
• Calculated Molecular Weight: 83 aa, 9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC093738
• Gene Symbol: PDE6H
• Gene ID (NCBI): 5149
• RRID: AB_2878509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13956
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	bioRxiv; Molecular Mechanisms Limiting the Therapeutic Window of AAV Gene Therapy in Mouse Models of Blue Cone Monochromacy; Authors - Brooke A Brothers
mouse	IF	Res Sq; Molecular Mechanisms Limiting the Therapeutic Window of AAV Gene Therapy in Mouse Models of Blue Cone Monochromacy; Authors - Wen-Tao Deng