PDF Polyclonal antibody, PBS Only

• 

  IHC staining of human liver cancer using 24842-1-AP (same clone as 24842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 24842-1-AP (same clone as 24842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 24842-1-AP (same clone as 24842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24842-1-AP (same clone as 24842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24842-1-AP (PDF Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24842-1-AP (same clone as 24842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24842-1-AP (PDF Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 24842-1-AP (same clone as 24842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24842-1-PBS in a different storage buffer formulation.

PDF Polyclonal Antibody for IHC, ELISA

Cat No. 24842-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

EC:3.5.1.88, PDF1A

---

Product Information

24842-1-PBS targets PDF in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18233

  Product name: Recombinant human PDF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-243 aa of bc019912

  Sequence: ALSLRPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND

• Full Name: peptide deformylase (mitochondrial)
• Calculated Molecular Weight: 243 aa, 27 kDa
• GenBank Accession Number: bc019912
• Gene Symbol: PDF
• Gene ID (NCBI): 64146
• RRID: AB_2879753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBH1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.