PDF Polyclonal antibody

• 

  IHC staining of human liver cancer using 24842-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 24842-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 24842-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 24842-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24842-1-AP (PDF Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 24842-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24842-1-AP (PDF Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver cancer using 24842-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24842-1-AP (PDF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PDF Polyclonal Antibody for IHC, ELISA

Cat No. 24842-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EC:3.5.1.88, PDF1A

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24842-1-AP targets PDF in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18233

  Product name: Recombinant human PDF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-243 aa of bc019912

  Sequence: ALSLRPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND

• Full Name: peptide deformylase (mitochondrial)
• Calculated Molecular Weight: 243 aa, 27 kDa
• GenBank Accession Number: bc019912
• Gene Symbol: PDF
• Gene ID (NCBI): 64146
• RRID: AB_2879753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBH1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Pharmacol; Hypoxia-induced tRF-3Thr-CGT promotes hepatocellular carcinoma progression via mitochondrial energy metabolism remodeling dependent on the mtDNA-translation mechanism; Authors - Xianzhi Qu