Anti-Mouse PDGFR beta/CD140b Rabbit Recombinant Antibody

PDGFR beta/CD140b Uni-rAb® Recombinant Antibody for FC

Cat No. 98207-1-RR
Clone No.241754F6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

241754F6, Beta platelet-derived growth factor receptor, Beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, CD140b

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98207-1-RR targets PDGFR beta/CD140b in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1533

Product name: Recombinant Mouse PDGFR beta protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 32-531 aa of NM_008809.2

Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV

Predict reactive species
Full Name platelet derived growth factor receptor, beta polypeptide
Calculated Molecular Weight123kDa
GenBank Accession NumberNM_008809.2
Gene Symbol PDGFR beta
Gene ID (NCBI) 18596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP05622-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

The Platelet-Derived Growth Factor Receptor Beta (PDGFR beta, also known as CD140b) is a receptor tyrosine kinase that plays a crucial role in various cellular processes, including cell proliferation, migration, and survival. In mice, PDGFR beta is particularly significant due to its expression in pericytes, which are cells that reside on the walls of capillaries and play a vital role in maintaining vascular stability and integrity (PMID: 20738866). In the central nervous system (CNS) of mice, PDGFR beta is predominantly expressed in pericytes and vascular smooth muscle cells. It is involved in the formation and maintenance of the blood-brain barrier, as well as in the regulation of angiogenesis and vascular stability. Research in mouse models has shown that PDGFR beta signaling is crucial for tissue repair and functional recovery after stroke. Mice with disrupted PDGFR beta signaling exhibit delayed recovery and increased infarction volume following cerebral ischemia (PMID: 21952111).

Protocols

Product Specific Protocols
FC protocol for PDGFR beta/CD140b antibody 98207-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...