PDS5A Monoclonal antibody, PBS Only

• 

  WB analysis using 67520-1-Ig (same clone as 67520-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67520-1-Ig (PDS5A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67520-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67520-1-Ig (same clone as 67520-1-PBS)

  WB result of PDS5A antibody (67520-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PDS5A transfected HeLa cells. This data was developed using the same antibody clone with 67520-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67520-1-Ig (same clone as 67520-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67520-1-Ig (PDS5A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67520-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67520-1-Ig (same clone as 67520-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67520-1-Ig (PDS5A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67520-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67520-1-Ig (same clone as 67520-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PDS5A antibody (67520-1-Ig, Clone: 1C8D4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67520-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67520-1-Ig (same clone as 67520-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PDS5A antibody (67520-1-Ig, Clone: 1C8D4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67520-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PDS5A Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67520-1-PBS

Clone No.1C8D4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1C8D4, Cell proliferation-inducing gene 54 protein, KIAA0648, PDS5, PIG54

---

Product Information

67520-1-PBS targets PDS5A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11525

  Product name: Recombinant human PDS5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-378 aa of BC009650

  Sequence: VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR

• Full Name: PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1297 aa, 147 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC009650
• Gene Symbol: PDS5A
• Gene ID (NCBI): 23244
• RRID: AB_2882740
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q29RF7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.