PEBP1 Monoclonal antibody, PBS Only

• 

  WB analysis of fetal human brain using 66438-1-Ig (same clone as 66438-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66438-1-Ig (PEBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66438-1-Ig (same clone as 66438-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66438-1-Ig (PEBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Neuro-2a using 66438-1-Ig (same clone as 66438-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 66438-1-Ig (PEBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 66438-1-Ig (same clone as 66438-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 66438-1-Ig (PEBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66438-1-Ig (same clone as 66438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66438-1-Ig (PEBP1 Antibody) at dilution of 1:500 (under 10x lens). proteolytic pre-treatment mediated antigen retrieved with Tris-EDTA buffer (pH9). This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66438-1-Ig (same clone as 66438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66438-1-Ig (PEBP1 Antibody) at dilution of 1:500 (under 40x lens). proteolytic pre-treatment mediated antigen retrieved with Tris-EDTA buffer (pH9). This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-12 using 66438-1-Ig (same clone as 66438-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-12 cells using PEBP1 antibody (66438-1-Ig, Clone: 2D4D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 66438-1-Ig (same clone as 66438-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using PEBP1 antibody (66438-1-Ig, Clone: 2D4D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-12 using 66438-1-Ig (same clone as 66438-1-PBS)

  1X10^6 PC-12 cells were intracellularly stained with 0.4 ug Anti-Human PEBP1 (66438-1-Ig, Clone:2D4D11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66438-1-PBS in a different storage buffer formulation.

PEBP1 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 66438-1-PBS

Clone No.2D4D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

RKIP, HCNP, HCNPpp, Neuropolypeptide h3, PBP

---

Product Information

66438-1-PBS targets PEBP1 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0864

  Product name: Recombinant human PEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-187 aa of BC008714

  Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

• Full Name: phosphatidylethanolamine binding protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 23-27 kDa
• GenBank Accession Number: BC008714
• Gene Symbol: PEBP1
• Gene ID (NCBI): 5037
• RRID: AB_2881808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P30086
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.