Tested Applications
| Positive WB detected in | fetal human brain tissue, Neuro-2a cells, PC-12 cells, rat brain tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
66438-1-Ig targets PEBP1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0864 Product name: Recombinant human PEBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-187 aa of BC008714 Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK Predict reactive species |
| Full Name | phosphatidylethanolamine binding protein 1 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 23-27 kDa |
| GenBank Accession Number | BC008714 |
| Gene Symbol | PEBP1 |
| Gene ID (NCBI) | 5037 |
| RRID | AB_2881808 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P30086 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PEBP1 antibody 66438-1-Ig | Download protocol |
| IF protocol for PEBP1 antibody 66438-1-Ig | Download protocol |
| IHC protocol for PEBP1 antibody 66438-1-Ig | Download protocol |
| WB protocol for PEBP1 antibody 66438-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

















