PEBP1 Monoclonal antibody

PEBP1 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66438-1-Ig
Clone No.2D4D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

RKIP, PEBP 1, PEBP, PBP, Neuropolypeptide h3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, Neuro-2a cells, PC-12 cells, rat brain tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66438-1-Ig targets PEBP1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0864

Product name: Recombinant human PEBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 83-187 aa of BC008714

Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Predict reactive species
Full Name phosphatidylethanolamine binding protein 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 23-27 kDa
GenBank Accession NumberBC008714
Gene Symbol PEBP1
Gene ID (NCBI) 5037
RRIDAB_2881808
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP30086
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.

Protocols

Product Specific Protocols
WB protocol for PEBP1 antibody 66438-1-IgDownload protocol
IHC protocol for PEBP1 antibody 66438-1-IgDownload protocol
IF protocol for PEBP1 antibody 66438-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC

Heliyon

Metabolomics reveals that ferroptosis participates in bisphenol A-induced testicular injury

Authors - Ling Kan Chi
Loading...
||
New chat Able
正在加载,请稍候...