Tested Applications
| Positive WB detected in | human peripheral blood platelets, HUVEC cells, Jurkat cells, THP-1 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human tonsillitis tissue, human placenta tissue, human renal cell carcinoma tissue, human hepatocirrhosis tissue, human kidney tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human endometrial cancer tissue, human tonsillitis tissue |
| Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 123 publications below |
| IHC | See 190 publications below |
| IF | See 265 publications below |
| IP | See 1 publications below |
| FC | See 2 publications below |
Product Information
11265-1-AP targets CD31 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, canine, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1787 Product name: Recombinant human CD31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species |
| Full Name | platelet/endothelial cell adhesion molecule |
| Calculated Molecular Weight | 83 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | BC022512 |
| Gene Symbol | CD31 |
| Gene ID (NCBI) | 5175 |
| ENSEMBL Gene ID | ENSG00000261371 |
| RRID | AB_2299349 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16284 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD31 antibody 11265-1-AP | Download protocol |
| IHC protocol for CD31 antibody 11265-1-AP | Download protocol |
| IP protocol for CD31 antibody 11265-1-AP | Download protocol |
| WB protocol for CD31 antibody 11265-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Aberrant Notch-signaling promotes tumor angiogenesis in esophageal squamous-cell carcinoma | ||
Signal Transduct Target Ther Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis | ||
Bioact Mater Li-Mg-Si bioceramics provide a dynamic immuno-modulatory and repair-supportive microenvironment for peripheral nerve regeneration | ||
Nat Commun Four-dimensional hydrogel dressing adaptable to the urethral microenvironment for scarless urethral reconstruction | ||
Sci Transl Med Selective targeting of multiple myeloma cells with a monoclonal antibody recognizing the ubiquitous protein CD98 heavy chain. | ||
Cancer Commun (Lond) Glutamine metabolic microenvironment drives M2 macrophage polarization to mediate trastuzumab resistance in HER2-positive gastric cancer |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sai Sindhura (Verified Customer) (01-08-2026) | VERY GOOD ANTIBODY
|
FH Maelle (Verified Customer) (11-29-2024) | ph9 Human FFPE
|













































