Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, LNCaP cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
30425-1-AP targets PFKFB2 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag32347 Product name: Recombinant human PFKFB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-505 aa of BC075076 Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Predict reactive species |
Full Name | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
Calculated Molecular Weight | 505 aa, 58 kDa |
Observed Molecular Weight | 50-58 kDa |
GenBank Accession Number | BC075076 |
Gene Symbol | PFKFB2 |
Gene ID (NCBI) | 5208 |
RRID | AB_3086311 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60825 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PFKFB2 antibody 30425-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |