PFKFB2 Polyclonal antibody

• 

  WB analysis using 30425-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30425-1-AP (PFKFB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PFKFB2 Polyclonal Antibody for WB, ELISA

Cat No. 30425-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

6PF 2 K/Fru 2,6 P2ase 2, DKFZp781D2217, PFK 2/FBPase 2, PFK/FBPase 2, PFKFB2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30425-1-AP targets PFKFB2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32347

  Product name: Recombinant human PFKFB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-505 aa of BC075076

  Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD

• Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
• Calculated Molecular Weight: 505 aa, 58 kDa
• Observed Molecular Weight: 50-58 kDa
• GenBank Accession Number: BC075076
• Gene Symbol: PFKFB2
• Gene ID (NCBI): 5208
• RRID: AB_3086311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60825
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.