PGLYRP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01966-2

  Sandwich ELISA standard curve of MP01966-2, Human PGLYRP1 Recombinant Matched Antibody Pair - PBS only. 85610-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3122. 85610-1-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL

• 

  Sample test of MP01966-2

  Saliva of six individual healthy human donors was measured. The human PGLYRP1 concentration of detected samples was determined to be 27.47 ng/mL with a range of 9.3 - 58.4 ng/mL.

• 

  Cytometric bead array standard curve of MP01966-2

  Cytometric bead array standard curve of MP01966-2, PGLYRP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85610-3-PBS. Detection antibody: 85610-1-PBS. Standard: Eg3122. Range: 1.563-50 ng/mL.

PGLYRP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85610-3-PBS

Clone No.243004F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

PGLYRP, PGRP, PGRP S, PGRPS, PGRP-S

---

Product Information

85610-3-PBS targets PGLYRP1 as part of a matched antibody pair:

MP01966-2: 85610-3-PBS capture and 85610-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3122

  Product name: Recombinant Human PGLYRP1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-196 aa of NM_005091.2

  Sequence: QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

• Full Name: peptidoglycan recognition protein 1
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: NM_005091.2
• Gene Symbol: PGLYRP1
• Gene ID (NCBI): 8993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75594
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.