Tested Applications
| Positive FC (Intra) detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-82965 targets PGM5 in FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34399 Product name: Recombinant human PGM5 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-80 aa of NM_021965 Sequence: MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSRTAIEIVV Predict reactive species |
| Full Name | phosphoglucomutase 5 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | NM_021965 |
| Gene Symbol | PGM5 |
| Gene ID (NCBI) | 5239 |
| RRID | AB_3673156 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15124 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Phosphoglucomutase-like protein 5 (also known as aciculin) is an enzyme encoded by the PGM5 gene. Gene functional studies show that PGM5 is similar to PGM1 but lacks enzymatic activity. PGM5 is tightly associated with the actin cytoskeleton and has primarily been investigated as an adhesion protein. It also functions as a cytoskeletal component of cell-matrix and cell-cell contacts in muscle and non-muscle cells. (PMID: 35819729)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 PGM5 antibody CL488-82965 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

