PGRMC1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66372-1-Ig (same clone as 66372-1-PBS)

  WB result of PGRMC1 antibody (66372-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PGRMC1 transfected HEK-293 cells. This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66372-1-Ig (same clone as 66372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 66372-1-Ig (same clone as 66372-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66372-1-Ig (same clone as 66372-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66372-1-Ig (same clone as 66372-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human ovary tumor using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human ovary tumor using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 66372-1-Ig (same clone as 66372-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:2000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004). This data was developed using the same antibody clone with 66372-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PGRMC1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 66372-1-PBS

Clone No.1C10D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

PGRMC, mPR, Membrane-associated progesterone receptor component 1, HPR6.6, 1C10D11

---

Product Information

66372-1-PBS targets PGRMC1 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3643

  Product name: Recombinant human PGRMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-195 aa of BC034238

  Sequence: YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

• Full Name: progesterone receptor membrane component 1
• Calculated Molecular Weight: 195 aa, 22 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC034238
• Gene Symbol: PGRMC1
• Gene ID (NCBI): 10857
• RRID: AB_2881751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00264
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Progesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297).