PGRMC1 Monoclonal antibody

• 

  WB analysis using 66372-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of HEK-293 using 66372-1-Ig

  WB result of PGRMC1 antibody (66372-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PGRMC1 transfected HEK-293 cells.

• 

  WB analysis of fetal human brain using 66372-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 66372-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66372-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human ovary tumor using 66372-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human ovary tumor using 66372-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of A549 using 66372-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:2000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004).

• Featured Product
• KD/KO Validated

PGRMC1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66372-1-Ig

Clone No.1C10D11

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

PGRMC, mPR, Membrane-associated progesterone receptor component 1, HPR6.6, 1C10D11

---

Tested Applications

• Positive WB detected in: A549 cells, fetal human brain tissue, MCF-7 cells, NIH/3T3 cells, HEK-293 cells, HeLa cells, Jurkat cells, K-562 cells, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human ovary tumor tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human ovary tumor tissue
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

66372-1-Ig targets PGRMC1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3643

  Product name: Recombinant human PGRMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-195 aa of BC034238

  Sequence: YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

• Full Name: progesterone receptor membrane component 1
• Calculated Molecular Weight: 195 aa, 22 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC034238
• Gene Symbol: PGRMC1
• Gene ID (NCBI): 10857
• RRID: AB_2881751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00264
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Progesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF,WB	Biol Chem; A progesterone receptor membrane component 1 antagonist induces large vesicles independent of progesterone receptor membrane component 1 expression.; Authors - Lihua Wang-Eckhardt