PGRMC1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PGRMC1 Monoclonal antibody (66372-1-Ig)

• Featured Product
• KD/KO Validated

PGRMC1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66372-1-Ig Copied!

Clone No. 1C10D11

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA
For FC, select conjugated version.

Synonyms

1C10D11, HPR6.6, Membrane-associated progesterone receptor component 1, mPR, PGRMC

• 

  WB analysis of HEK-293 using 66372-1-Ig

  WB result of PGRMC1 antibody (66372-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PGRMC1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66372-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 66372-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 66372-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66372-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66372-1-Ig (PGRMC1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human ovary tumor using 66372-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human ovary tumor using 66372-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 66372-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using PGRMC1 antibody (66372-1-Ig, Clone: 1C10D11 ) at dilution of 1:2000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PGRMC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, fetal human brain tissue, MCF-7 cells, NIH/3T3 cells, HEK-293 cells, HeLa cells, Jurkat cells, K-562 cells, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human ovary tumor tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human ovary tumor tissue
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66372-1-Ig targets PGRMC1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3643

  Product name: Recombinant human PGRMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-195 aa of BC034238

  Sequence: KIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

• Full Name: progesterone receptor membrane component 1
• Calculated Molecular Weight: 195 aa, 22 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC034238
• Gene Symbol: PGRMC1
• Gene ID (NCBI): 10857
• RRID: AB_2881751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00264
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Progesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297).

Publications

What published studies show

The PGRMC1 Monoclonal antibody (1C10D11), catalog number 66372-1-Ig, has a total of 1 citation. The cited publication appeared in Biol Chem and investigated how a progesterone receptor membrane component 1 antagonist induces large vesicle formation independent of PGRMC1 expression. The research field encompasses cell biology and membrane dynamics, with the antibody applied in Western blot and immunofluorescence assays on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Biol Chem; A progesterone receptor membrane component 1 antagonist induces large vesicles independent of progesterone receptor membrane component 1 expression.; Authors - Lihua Wang-Eckhardt