Product Information
60249-1-PBS targets PGRMC2 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20077 Product name: Recombinant human PGRMC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 55-145 aa of BC016692 Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI Predict reactive species |
Full Name | progesterone receptor membrane component 2 |
Calculated Molecular Weight | 223 aa, 24 kDa |
Observed Molecular Weight | 24 kDa, 28 kDa |
GenBank Accession Number | BC016692 |
Gene Symbol | PGRMC2 |
Gene ID (NCBI) | 10424 |
RRID | AB_2881370 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15173 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).