PGRMC2 Monoclonal antibody, PBS Only

• 

  WB analysis using 60249-1-Ig (same clone as 60249-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60249-1-Ig (PGRMC2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 60249-1-Ig (same clone as 60249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 60249-1-Ig (PGRMC2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60249-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 60249-1-Ig (same clone as 60249-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 60249-1-Ig (PGRMC2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60249-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human cervical cancer using 60249-1-Ig (same clone as 60249-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using PGRMC2 antibody (60249-1-Ig, Clone: 5F10D7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60249-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human cervical cancer using 60249-1-Ig (same clone as 60249-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using PGRMC2 antibody (60249-1-Ig, Clone: 5F10D7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60249-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 60249-1-Ig (same clone as 60249-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PGRMC2 (60249-1-Ig, Clone:5F10D7) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (66360-2-Ig, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 60249-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PGRMC2 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 60249-1-PBS

Clone No.5F10D7

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

5F10D7, DG6, Membrane-associated progesterone receptor component 2, PMBP

---

Product Information

60249-1-PBS targets PGRMC2 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20077

  Product name: Recombinant human PGRMC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 55-145 aa of BC016692

  Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI

• Full Name: progesterone receptor membrane component 2
• Calculated Molecular Weight: 223 aa, 24 kDa
• Observed Molecular Weight: 24 kDa, 28 kDa
• GenBank Accession Number: BC016692
• Gene Symbol: PGRMC2
• Gene ID (NCBI): 10424
• RRID: AB_2881370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15173
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).