PGRMC2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PGRMC2 Monoclonal antibody (60249-1-Ig)

• Featured Product
• KD/KO Validated

PGRMC2 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 60249-1-Ig Copied!

Clone No. 5F10D7

Publications (4)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

5F10D7, DG6, Membrane-associated progesterone receptor component 2, PMBP

• 

  WB analysis using 60249-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60249-1-Ig (PGRMC2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 60249-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 60249-1-Ig (PGRMC2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 60249-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 60249-1-Ig (PGRMC2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human cervical cancer using 60249-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using PGRMC2 antibody (60249-1-Ig, Clone: 5F10D7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human cervical cancer using 60249-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using PGRMC2 antibody (60249-1-Ig, Clone: 5F10D7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 60249-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PGRMC2 (60249-1-Ig, Clone:5F10D7) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (66360-2-Ig, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PGRMC2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells, HepG2 cells, pig liver tissue
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human cervical cancer tissue
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60249-1-Ig targets PGRMC2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20077

  Product name: Recombinant human PGRMC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 55-145 aa of BC016692

  Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI

• Full Name: progesterone receptor membrane component 2
• Calculated Molecular Weight: 223 aa, 24 kDa
• Observed Molecular Weight: 24 kDa, 28 kDa
• GenBank Accession Number: BC016692
• Gene Symbol: PGRMC2
• Gene ID (NCBI): 10424
• RRID: AB_2881370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15173
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).

Publications

What published studies show

The PGRMC2 Monoclonal antibody (5F10D7), catalog number 60249-1-Ig, has 4 total citations. These appear in the journals Journal of Cell Science, Biological Chemistry, International Journal of Clinical and Experimental Pathology, and iBrain. The associated research fields include cell biology (lanosterol demethylase surveillance), biochemistry (progesterone receptor membrane components), breast cancer cell migration, and neuroscience (neuronal activity and epileptic seizures).

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Sci; Topology surveillance of the lanosterol demethylase CYP51A1 by Signal Peptide Peptidase; Authors - Nikita Sergejevs
human	WB	Biol Chem; A progesterone receptor membrane component 1 antagonist induces large vesicles independent of progesterone receptor membrane component 1 expression.; Authors - Lihua Wang-Eckhardt
human	WB	Int J Clin Exp Pathol; Quantitative proteomic analysis identifies new effectors of FOXM1 involved in breast cancer cell migration.; Authors - Xiaojuan Ye ; KD Validated
mouse	WB,IF	Ibrain; Progesterone receptor membrane component 2 regulates the neuronal activity and participates in epileptic seizures in experimental mice; Authors - Xiaoyan Yang