• Featured Product
  • KD/KO Validated

PGRMC2 Monoclonal antibody

PGRMC2 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 60249-1-Ig
Clone No.5F10D7

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

5F10D7, DG6, Membrane-associated progesterone receptor component 2, PMBP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, LNCaP cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells, HepG2 cells, pig liver tissue
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman cervical cancer tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60249-1-Ig targets PGRMC2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20077

Product name: Recombinant human PGRMC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 55-145 aa of BC016692

Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI

Predict reactive species
Full Name progesterone receptor membrane component 2
Calculated Molecular Weight 223 aa, 24 kDa
Observed Molecular Weight 24 kDa, 28 kDa
GenBank Accession NumberBC016692
Gene Symbol PGRMC2
Gene ID (NCBI) 10424
RRIDAB_2881370
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15173
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).

Protocols

Product Specific Protocols
FC protocol for PGRMC2 antibody 60249-1-IgDownload protocol
IF protocol for PGRMC2 antibody 60249-1-IgDownload protocol
IHC protocol for PGRMC2 antibody 60249-1-IgDownload protocol
WB protocol for PGRMC2 antibody 60249-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Cell Sci

Topology surveillance of the lanosterol demethylase CYP51A1 by Signal Peptide Peptidase

Authors - Nikita Sergejevs
humanWB

Biol Chem

A progesterone receptor membrane component 1 antagonist induces large vesicles independent of progesterone receptor membrane component 1 expression.

Authors - Lihua Wang-Eckhardt
humanWB

Int J Clin Exp Pathol

Quantitative proteomic analysis identifies new effectors of FOXM1 involved in breast cancer cell migration.

Authors - Xiaojuan Ye
  • KD Validated
mouseWB,IF

Ibrain

Progesterone receptor membrane component 2 regulates the neuronal activity and participates in epileptic seizures in experimental mice

Authors - Xiaoyan Yang
Loading...
||
New chat

Able

正在加载,请稍候...