Use Able AI chat for product recommendations
  • Featured Product

PHGDH Recombinant monoclonal antibody

PHGDH Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 81986-1-RR
Clone No.5L16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), IP, ELISA

3 PGDH, 3PGDH, 3-PGDH, D-3-phosphoglycerate dehydrogenase, EC:1.1.1.37

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, mouse pancreas tissue, rat pancreas tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81986-1-RR targets PHGDH in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6445

Product name: Recombinant human PHGDH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 186-533 aa of BC000303

Sequence: FGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Predict reactive species
Full Name phosphoglycerate dehydrogenase
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC000303
Gene Symbol PHGDH
Gene ID (NCBI) 26227
RRIDAB_2935595
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43175
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHGDH(D-3-phosphoglycerate dehydrogenase) is also named as 3-PGDH, PGDH3 and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. It catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor. 3-PGDH deficiency is a rare recessive inborn error in the biosynthesis of the amino acid L-serine characterized clinically by congenital microcephaly, psychomotor retardation, and intractable seizures(PMID:19235232 ).

Protocols

Product Specific Protocols
FC protocol for PHGDH antibody 81986-1-RRDownload protocol
IHC protocol for PHGDH antibody 81986-1-RRDownload protocol
IP protocol for PHGDH antibody 81986-1-RRDownload protocol
WB protocol for PHGDH antibody 81986-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Lett

PGK1/PHGDH axis drives radioresistance in glioblastoma stem cells.

Authors - Zhangchun Cheng
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...