PHYH Polyclonal antibody, PBS Only

• 

  WB analysis of human liver using 12858-1-AP (same clone as 12858-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12858-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 12858-1-AP (same clone as 12858-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12858-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12858-1-AP (same clone as 12858-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12858-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12858-1-AP (same clone as 12858-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12858-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12858-1-AP (same clone as 12858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 12858-1-AP (PHYH antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12858-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12858-1-AP (same clone as 12858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 12858-1-AP (PHYH antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12858-1-PBS in a different storage buffer formulation.

PHYH Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12858-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12858-1-PBS targets PHYH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3569

  Product name: Recombinant human PHYH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-338 aa of BC029512

  Sequence: MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

• Full Name: phytanoyl-CoA 2-hydroxylase
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 36 kDa, 70 kDa
• GenBank Accession Number: BC029512
• Gene Symbol: PHYH
• Gene ID (NCBI): 5264
• RRID: AB_2163745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14832
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHYH (Phytanoyl-CoA 2-hydroxylase), also known as Phytanic acid oxidase or Phytanoyl-CoA alpha-hydroxylase, is a peroxisomal enzyme which converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. It catalyzes the first step in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. Mutations in this gene can cause Refsum disease (RD) and deficient protein activity can cause Zellweger syndrome and rhizomelic chondrodysplasia punctata. This antibody (12858-1-AP) detects two bands: 36kd and 70kd. The 70kd band may probably be the dimeric form of PHYH.