PHYH Polyclonal antibody

• 

  WB analysis of human liver using 12858-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 12858-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12858-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12858-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 12858-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 12858-1-AP (PHYH antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 12858-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 12858-1-AP (PHYH antibody) at dilution of 1:50 (under 40x lens).

PHYH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12858-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

LN1, LNAP1, PAHX, PHYH, PHYH1, Phytanic acid oxidase, phytanoyl CoA 2 hydroxylase, RD

---

Tested Applications

• Positive WB detected in: human liver tissue, HEK-293 cells, human kidney tissue, Jurkat cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below

Product Information

12858-1-AP targets PHYH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3569

  Product name: Recombinant human PHYH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-338 aa of BC029512

  Sequence: MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

• Full Name: phytanoyl-CoA 2-hydroxylase
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 36 kDa, 70 kDa
• GenBank Accession Number: BC029512
• Gene Symbol: PHYH
• Gene ID (NCBI): 5264
• RRID: AB_2163745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14832
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHYH (Phytanoyl-CoA 2-hydroxylase), also known as Phytanic acid oxidase or Phytanoyl-CoA alpha-hydroxylase, is a peroxisomal enzyme which converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. It catalyzes the first step in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. Mutations in this gene can cause Refsum disease (RD) and deficient protein activity can cause Zellweger syndrome and rhizomelic chondrodysplasia punctata. This antibody (12858-1-AP) detects two bands: 36kd and 70kd. The 70kd band may probably be the dimeric form of PHYH.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	PLoS Genet; Tysnd1 deficiency in mice interferes with the peroxisomal localization of PTS2 enzymes, causing lipid metabolic abnormalities and male infertility.; Authors - Mizuno Yumi Y
rat	WB	Oncotarget; Proteomics and metabolomics analysis of hepatic mitochondrial metabolism in alcohol-preferring and non-preferring rats.; Authors - Hao-Long Zeng
pig	WB	Sci Rep; Proteomics analysis reveals the effect of 1α,25(OH)2VD3-glycosides on development of early testes in piglets.; Authors - Haodong Chen
rat	WB	J Ethnopharmacol; Isobaric tags for relative and absolute quantitation (iTRAQ)-based proteomics for the investigation of the effect of Hugan Qingzhi on non-alcoholic fatty liver disease in rats.; Authors - Xiaorui Yao
mouse	WB,IHC	J Hepatocell Carcinoma; Liver Regeneration-Related Genes of Nontumor Liver Tissues Predict the Prognosis of Patients with Hepatocellular Carcinoma; Authors - Yanchao Xu
human	WB	Nat Cell Biol; PEX39 facilitates the peroxisomal import of PTS2-containing proteins; Authors - Walter W Chen