PHYH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PHYH Polyclonal antibody (12858-1-AP)

PHYH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12858-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

EC:1.14.11.18, phytanoyl CoA 2 hydroxylase, Phytanoyl-CoA alpha-hydroxylase, Phytanoyl-CoA dioxygenase, peroxisomal

• 

  WB analysis of human liver using 12858-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12858-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12858-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 12858-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12858-1-AP (PHYH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 12858-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12858-1-AP (PHYH antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 12858-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12858-1-AP (PHYH antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PHYH in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue, HEK-293 cells, human kidney tissue, Jurkat cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12858-1-AP targets PHYH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3569

  Product name: Recombinant human PHYH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-338 aa of BC029512

  Sequence: MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

• Full Name: phytanoyl-CoA 2-hydroxylase
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 36 kDa, 70 kDa
• GenBank Accession Number: BC029512
• Gene Symbol: PHYH
• Gene ID (NCBI): 5264
• RRID: AB_2163745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14832
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHYH (Phytanoyl-CoA 2-hydroxylase), also known as Phytanic acid oxidase or Phytanoyl-CoA alpha-hydroxylase, is a peroxisomal enzyme which converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. It catalyzes the first step in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. Mutations in this gene can cause Refsum disease (RD) and deficient protein activity can cause Zellweger syndrome and rhizomelic chondrodysplasia punctata. This antibody (12858-1-AP) detects two bands: 36kd and 70kd. The 70kd band may probably be the dimeric form of PHYH.

Publications

What published studies show

The PHYH polyclonal antibody (Cat# 12858-1-AP) has 6 citations across journals including Nature Cell Biology, Journal of Ethnopharmacology, Oncotarget, Scientific Reports, Journal of Hepatocellular Carcinoma, and PLoS Genetics. Research fields span peroxisomal PTS2 protein import, non-alcoholic fatty liver disease, hepatic mitochondrial metabolism, early testicular development, hepatocellular carcinoma prognosis, and lipid metabolic abnormalities related to male infertility. Applications cited include WB and IHC in mouse, rat, and pig species.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Cell Biol; PEX39 facilitates the peroxisomal import of PTS2-containing proteins; Authors - Walter W Chen
rat	WB	J Ethnopharmacol; Isobaric tags for relative and absolute quantitation (iTRAQ)-based proteomics for the investigation of the effect of Hugan Qingzhi on non-alcoholic fatty liver disease in rats.; Authors - Xiaorui Yao
rat	WB	Oncotarget; Proteomics and metabolomics analysis of hepatic mitochondrial metabolism in alcohol-preferring and non-preferring rats.; Authors - Hao-Long Zeng
pig	WB	Sci Rep; Proteomics analysis reveals the effect of 1α,25(OH)2VD3-glycosides on development of early testes in piglets.; Authors - Haodong Chen
mouse	WB,IHC	J Hepatocell Carcinoma; Liver Regeneration-Related Genes of Nontumor Liver Tissues Predict the Prognosis of Patients with Hepatocellular Carcinoma; Authors - Yanchao Xu
mouse	WB	PLoS Genet; Tysnd1 deficiency in mice interferes with the peroxisomal localization of PTS2 enzymes, causing lipid metabolic abnormalities and male infertility.; Authors - Mizuno Yumi Y