Product Information
81857-1-PBS targets PIN1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag0767 Product name: Recombinant human PIN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC002899 Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE Predict reactive species | 
                                    
| Full Name | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 
| Calculated Molecular Weight | 18 kDa | 
| Observed Molecular Weight | 18 kDa | 
| GenBank Accession Number | BC002899 | 
| Gene Symbol | PIN1 | 
| Gene ID (NCBI) | 5300 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q13526 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
Background Information
PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).















