• Featured Product
  • KD/KO Validated

PIN1 Recombinant monoclonal antibody

PIN1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 81857-1-RR
Clone No.5N20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, ELISA

Pin 1, Peptidyl-prolyl cis-trans isomerase Pin1, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, EC:5.2.1.8, 5N20

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, Jurkat cells, K-562 cells, mouse brain tissue, rat brain tissue, pig brain tissue
Positive IP detected inHepG2 cells, NIH/3T3 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81857-1-RR targets PIN1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0767

Product name: Recombinant human PIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-163 aa of BC002899

Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Predict reactive species
Full Name peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Calculated Molecular Weight 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002899
Gene Symbol PIN1
Gene ID (NCBI) 5300
RRIDAB_2935587
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13526
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Protocols

Product Specific Protocols
IF protocol for PIN1 antibody 81857-1-RRDownload protocol
IHC protocol for PIN1 antibody 81857-1-RRDownload protocol
IP protocol for PIN1 antibody 81857-1-RRDownload protocol
WB protocol for PIN1 antibody 81857-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...