Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, HEK-293 cells, mouse heart tissue, mouse kidney tissue | 
| Positive IHC detected in | human colon cancer tissue,  human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below | 
| IHC | See 3 publications below | 
Product Information
16009-1-AP targets PLA2G12A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8722 Product name: Recombinant human PLA2G12A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-189 aa of BC017218 Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL Predict reactive species | 
                                    
| Full Name | phospholipase A2, group XIIA | 
| Calculated Molecular Weight | 189 aa, 21 kDa | 
| Observed Molecular Weight | 21-24 kDa | 
| GenBank Accession Number | BC017218 | 
| Gene Symbol | PLA2G12A | 
| Gene ID (NCBI) | 81579 | 
| RRID | AB_2164314 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9BZM1 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
PLA2G12A (or PLA2G12) gene encodes group XII secreted phospholipase A2 (sPLA2) which catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Cellular arachidonate (AA) release and prostaglandin (PG) production is regulated by sPLA(2)s, groups III and XII. Group XII sPLA2 have relatively low specific activity and are structurally and functionally distinct from other sPLA2s. Cells transfected with group XII sPLA(2) exhibited abnormal morphology, suggesting a unique functional aspect of this enzyme. Role of sPLA2s as potential tumour biomarkers and therapeutic targets for various cancers have been reported.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PLA2G12A antibody 16009-1-AP | Download protocol | 
| IHC protocol for PLA2G12A antibody 16009-1-AP | Download protocol | 
| WB protocol for PLA2G12A antibody 16009-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Int J Cardiol Phospholipase A2 expression in coronary thrombus is increased in patients with recurrent cardiac events after acute myocardial infarction. | ||
Atherosclerosis Quantitative trait locus mapping in mice identifies phospholipase Pla2g12a as novel atherosclerosis modifier. | ||
Exp Ther Med Therapeutic effect of irbesartan combined with atorvastatin calcium in the treatment of rats with coronary heart disease. | ||
J Atheroscler Thromb The Expression of Groups IIE and V Phospholipase A2 is Associated with an Increased Expression of Osteogenic Molecules in Human Calcified Aortic Valves. | ||
Nat Commun Proteomic screens of SEL1L-HRD1 ER-associated degradation substrates reveal its role in glycosylphosphatidylinositol-anchored protein biogenesis | 





















