Product Information
66397-1-PBS targets PLA2G1B as part of a matched antibody pair:
MP51376-1: 66397-1-PBS capture and 66397-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human, pig |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8812 Product name: Recombinant human PLA2G1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species |
Full Name | phospholipase A2, group IB (pancreas) |
Calculated Molecular Weight | 70aa,8 kDa; 148aa,16 kDa |
Observed Molecular Weight | 13-16 kDa |
GenBank Accession Number | BC005386 |
Gene Symbol | PLA2G1B |
Gene ID (NCBI) | 5319 |
RRID | AB_2881771 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P04054 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |