PLCB2 Polyclonal antibody

• 

  WB analysis using 27456-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27456-1-AP (PLCB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27456-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27456-1-AP (PLCB2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 27456-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27456-1-AP (PLCB2 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of THP-1 using 27456-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using PLCB2 antibody (27456-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

PLCB2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27456-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PLC beta 2, Phospholipase C-beta-2, Phospholipase C beta 2, Phosphoinositide phospholipase C-beta-2, EC:3.1.4.11

---

Tested Applications

• Positive WB detected in: THP-1 cells, HL-60 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27456-1-AP targets PLCB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25771

  Product name: Recombinant human PLCB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC000939

  Sequence: MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLT

• Full Name: phospholipase C, beta 2
• Calculated Molecular Weight: 134 kDa
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC000939
• Gene Symbol: PLCB2
• Gene ID (NCBI): 5330
• RRID: AB_3085963
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00722
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLCB2 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2) is also named as PLC-beta-2. PLCB2 is a critical regulator of platelet responses upon activation (PMID: 27465150). NF-κB regulates expression of PLC-β2. The PLCB2 genes was found to be differentially expressed in human breast cancer MCF-7 cells, and to be associated with multidrug resistance (PMID: 2951275). The knockdown of PLCB2 suppressed cell viability and promoted cell apoptosis by activating the Ras/Raf/MAPK pathway. Thus, PLCB2 may utilized as a potential therapeutic target in patients with melanoma (PMID: 31746389).