CoraLite® Plus 488-conjugated PLCG1 Recombinant monoclonal antibody

• 

  IF Staining of HEK-293 using CL488-84941

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 PLCG1 antibody (CL488-84941, Clone: 242529A11 ) at dilution of 1:200.

PLCG1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84941

Clone No.242529A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1, EC:3.1.4.11, Phosphoinositide phospholipase C-gamma-1, Phospholipase C gamma 1, Phospholipase C II

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84941 targets PLCG1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27218

  Product name: Recombinant human PLCG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 467-563 aa of

  Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH

• Full Name: phospholipase C, gamma 1
• Calculated Molecular Weight: 149 kDa
• Gene Symbol: PLCG1
• Gene ID (NCBI): 5335
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19174
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Phosphoinositide phospholipase C-gamma-1 (PLCG1) which belongs to the phosphoinositide-specific phospholipase C (PLC) family, is activated by many extracellular stimuli including hormones, neurotransmitters, and growth factors and modulates several cellular and physiological functions necessary for tumorigeneses such as cell survival, migration, invasion, and angiogenesis by generating inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG) via hydrolysis of phosphatidylinositol 4,5-biphosphate (PIP2) (PMID: 9242915). Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCγ is activated by both receptor and non-receptor tyrosine kinases (PMID: 2472218). PLCγ forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCγ at Tyr771, 783, and 1248 (PMID: 1708307). It has also been shown that PKA-mediated phosphorylation at Ser1248 is inhibitory to PLCγ1 tyrosine phosphorylation and phospholipase activity in CD3-treated Jurkat cells (PMID: 1370476), suggesting that Ser1248 may be an allosteric regulator of PLCγ1 activity.