PLDN Monoclonal antibody, PBS Only (Capture)

PLDN Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 66558-1-PBS
Clone No.4F4C11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Pallidin, 4F4C11, BLOC-1 subunit 6, BLOC1S6, HPS9

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66558-1-PBS targets PLDN as part of a matched antibody pair:

MP51459-1: 66558-1-PBS capture and 66558-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18095

Product name: Recombinant human PLDN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-172 aa of BC004819

Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

Predict reactive species
Full Name pallidin homolog (mouse)
Calculated Molecular Weight 23~24 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC004819
Gene Symbol PLDN
Gene ID (NCBI) 26258
RRIDAB_2881919
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UL45
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Pallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion.

Loading...
||
New chat Able
正在加载,请稍候...