PLDN Monoclonal antibody

• 

  WB analysis using 66558-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66558-1-Ig (PLDN antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

PLDN Monoclonal Antibody for WB, ELISA

Cat No. 66558-1-Ig

Clone No.4F4C11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Pallidin, 4F4C11, BLOC-1 subunit 6, BLOC1S6, HPS9

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293 cells, Jurkat cells, ROS1728 cells, RAW 264.7 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66558-1-Ig targets PLDN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18095

  Product name: Recombinant human PLDN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-172 aa of BC004819

  Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

• Full Name: pallidin homolog (mouse)
• Calculated Molecular Weight: 23~24 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC004819
• Gene Symbol: PLDN
• Gene ID (NCBI): 26258
• RRID: AB_2881919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UL45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion.