Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, human kidney tissue, human skeletal muscle tissue, mouse lung tissue, mouse spleen tissue, mouse thymus tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
20389-1-AP targets PLEKHF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14228 Product name: Recombinant human PLEKHF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 180-279 aa of BC002744 Sequence: FVVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS Predict reactive species |
| Full Name | pleckstrin homology domain containing, family F (with FYVE domain) member 1 |
| Calculated Molecular Weight | 279 aa, 31 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC002744 |
| Gene Symbol | PLEKHF1 |
| Gene ID (NCBI) | 79156 |
| RRID | AB_10666430 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S99 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLEKHF1, also named as APPD, LAPF, and ZFYVE15, is a 279 amino acid protein, which contains one PH domain and one FYVE-type zinc finger. PLEKHF1 translocates to lysosome during apoptosis, localizing in the nucleus and cytoplsam. PLEKHF1 is highly expressed in heart and skeletal muscle and weakly expressed in brain, thymus, spleen, kidney, liver, small intestine, placenta and lung. PLEKHF1 may induce apoptosis through the lysosomal-mitochondrial pathway. PLEKHF1 modulates the protein content of the plasma membrane and was involved in different endocytosis events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PLEKHF1 antibody 20389-1-AP | Download protocol |
| IHC protocol for PLEKHF1 antibody 20389-1-AP | Download protocol |
| WB protocol for PLEKHF1 antibody 20389-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Breast Cancer Res Functional characterization of the 19q12 amplicon in grade III breast cancers.
| ||
Sci China Life Sci Local administration of liposomal-based Plekhf1 gene therapy attenuates pulmonary fibrosis by modulating macrophage polarization
|



















