Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, L02 cells, SMMC-7721 cells, HuH-7 cells, HSC-T6 cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
67369-1-Ig targets PNPLA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Rat, pig samples.
Tested Reactivity | Human, Rat, pig |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27407 Product name: Recombinant human PNPLA3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 229-339 aa of BC065195 Sequence: PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM Predict reactive species |
Full Name | patatin-like phospholipase domain containing 3 |
Observed Molecular Weight | 53 kDa |
GenBank Accession Number | BC065195 |
Gene Symbol | PNPLA3 |
Gene ID (NCBI) | 80339 |
RRID | AB_2882619 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9NST1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PNPLA3 belongs to a family of proteins that share a domain that was first identified in patatin, a major soluble protein of potato tubers with nonspecific acyl hydrolase activity. The domain differs from classical lipases by employing a catalytic dyad (Ser-Asp), rather than a catalytic triad, to effect hydrolysis. PNPLA3 is expressed primarily in liver and adipose tissue, in which it partitions to membranes and lipid droplets. Real-time PCR of cDNA from human tissues indicated that PNPLA3 expression was highest in the liver, followed by skin and adipose tissue. PNPLA3 is expressed at the highest levels in adipose tissue of mice. The PNPLA3 protein was expected at 50-70 kDa, as observed; the additional band at approximately 130-150 kDa is a oligomer bands. (PMID: 20385813, PMID: 24931521, PMID: 23023705)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PNPLA3 antibody 67369-1-Ig | Download protocol |
IHC protocol for PNPLA3 antibody 67369-1-Ig | Download protocol |
IF protocol for PNPLA3 antibody 67369-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |