PNPLA3 Monoclonal antibody

PNPLA3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67369-1-Ig
Clone No.1D2B11

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Acylglycerol O acyltransferase, Adiponutrin, ADPN, C22orf20, iPLA(2)epsilon, iPLA2 epsilon, PNPLA3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, L02 cells, SMMC-7721 cells, HuH-7 cells, HSC-T6 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67369-1-Ig targets PNPLA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Rat, pig samples.

Tested Reactivity Human, Rat, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27407

Product name: Recombinant human PNPLA3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 229-339 aa of BC065195

Sequence: PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM

Predict reactive species
Full Name patatin-like phospholipase domain containing 3
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC065195
Gene Symbol PNPLA3
Gene ID (NCBI) 80339
RRIDAB_2882619
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NST1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PNPLA3 belongs to a family of proteins that share a domain that was first identified in patatin, a major soluble protein of potato tubers with nonspecific acyl hydrolase activity. The domain differs from classical lipases by employing a catalytic dyad (Ser-Asp), rather than a catalytic triad, to effect hydrolysis. PNPLA3 is expressed primarily in liver and adipose tissue, in which it partitions to membranes and lipid droplets. Real-time PCR of cDNA from human tissues indicated that PNPLA3 expression was highest in the liver, followed by skin and adipose tissue. PNPLA3 is expressed at the highest levels in adipose tissue of mice. The PNPLA3 protein was expected at 50-70 kDa, as observed; the additional band at approximately 130-150 kDa is a oligomer bands. (PMID: 20385813, PMID: 24931521, PMID: 23023705)

Protocols

Product Specific Protocols
WB protocol for PNPLA3 antibody 67369-1-IgDownload protocol
IHC protocol for PNPLA3 antibody 67369-1-IgDownload protocol
IF protocol for PNPLA3 antibody 67369-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Hepatol

IL-6/STAT3 axis dictates the PNPLA3-mediated susceptibility to non-alcoholic fatty liver disease

Authors - Jiwoon Park
Loading...
||
New chat Able
正在加载,请稍候...