Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67369 targets PNPLA3 in IF/ICC applications and shows reactivity with Human, Rat samples.
| Tested Reactivity | Human, Rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27407 Product name: Recombinant human PNPLA3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 229-339 aa of BC065195 Sequence: PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM Predict reactive species |
| Full Name | patatin-like phospholipase domain containing 3 |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC065195 |
| Gene Symbol | PNPLA3 |
| Gene ID (NCBI) | 80339 |
| RRID | AB_2920121 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NST1 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PNPLA3 belongs to a family of proteins that share a domain that was first identified in patatin, a major soluble protein of potato tubers with nonspecific acyl hydrolase activity. The domain differs from classical lipases by employing a catalytic dyad (Ser-Asp), rather than a catalytic triad, to effect hydrolysis. PNPLA3 is expressed primarily in liver and adipose tissue, in which it partitions to membranes and lipid droplets. Real-time PCR of cDNA from human tissues indicated that PNPLA3 expression was highest in the liver, followed by skin and adipose tissue. PNPLA3 is expressed at the highest levels in adipose tissue of mice. The PNPLA3 protein was expected at 50-70 kDa, as observed; the additional band at approximately 130-150 kDa is a oligomer bands. (PMID: 20385813, PMID: 24931521, PMID: 23023705)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 PNPLA3 antibody CL594-67369 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

