CoraLite®594-conjugated PNPLA3 Monoclonal antibody

PNPLA3 Monoclonal Antibody for IF/ICC
Cat No. CL594-67369
Clone No.1D2B11

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

IF/ICC

Acylglycerol O acyltransferase, Adiponutrin, ADPN, C22orf20, iPLA(2)epsilon, iPLA2 epsilon, PNPLA3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67369 targets PNPLA3 in IF/ICC applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27407

Product name: Recombinant human PNPLA3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 229-339 aa of BC065195

Sequence: PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM

Predict reactive species
Full Name patatin-like phospholipase domain containing 3
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC065195
Gene Symbol PNPLA3
Gene ID (NCBI) 80339
RRIDAB_2920121
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NST1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PNPLA3 belongs to a family of proteins that share a domain that was first identified in patatin, a major soluble protein of potato tubers with nonspecific acyl hydrolase activity. The domain differs from classical lipases by employing a catalytic dyad (Ser-Asp), rather than a catalytic triad, to effect hydrolysis. PNPLA3 is expressed primarily in liver and adipose tissue, in which it partitions to membranes and lipid droplets. Real-time PCR of cDNA from human tissues indicated that PNPLA3 expression was highest in the liver, followed by skin and adipose tissue. PNPLA3 is expressed at the highest levels in adipose tissue of mice. The PNPLA3 protein was expected at 50-70 kDa, as observed; the additional band at approximately 130-150 kDa is a oligomer bands. (PMID: 20385813, PMID: 24931521, PMID: 23023705)

Protocols

Product Specific Protocols
IF protocol for CL594 PNPLA3 antibody CL594-67369Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...