POLR2F Monoclonal antibody, PBS Only

• 

  WB analysis using 68511-1-Ig (same clone as 68511-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68511-1-Ig (POLR2F antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68511-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68511-1-Ig (same clone as 68511-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68511-1-Ig (POLR2F antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68511-1-PBS in a different storage buffer formulation.

POLR2F Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68511-1-PBS

Clone No.2D4D12

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

WB, Indirect ELISA

Synonyms

HRBP14.4, POLR2F, POLRF, RPABC14.4, RPABC2, RPB14.4, RPB6, RPB6 homolog, RPC15

---

Product Information

68511-1-PBS targets POLR2F in WB, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7472

  Product name: Recombinant human POLR2F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-127 aa of BC003582

  Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

• Full Name: polymerase (RNA) II (DNA directed) polypeptide F
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC003582
• Gene Symbol: POLR2F
• Gene ID (NCBI): 5435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61218
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.