POLR2F Monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• POLR2F Monoclonal antibody, PBS Only (Detector) (68511-1-PBS)

POLR2F Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 68511-1-PBS

Clone No.2D4D12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

2D4D12, DNA-directed RNA polymerase II subunit F, DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide, DNA-directed RNA polymerases I, II, and III subunit RPABC2, HRBP14.4

• 

  WB analysis using 68511-1-Ig (same clone as 68511-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68511-1-Ig (POLR2F antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68511-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68511-1-Ig (same clone as 68511-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68511-1-Ig (POLR2F antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68511-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP51851-1

  Cytometric bead array sample test of MP51851-1, POLR2F Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68511-2-PBS. Detection antibody: 68511-1-PBS.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP51851-1

  Cytometric bead array standard curve of MP51851-1, POLR2F Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68511-2-PBS. Detection antibody: 68511-1-PBS. Standard:Ag7472. Range: 0.781-100 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

68511-1-PBS targets POLR2F as part of a matched antibody pair:

MP51851-1: 68511-2-PBS capture and 68511-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7472

  Product name: Recombinant human POLR2F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-127 aa of BC003582

  Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

• Full Name: polymerase (RNA) II (DNA directed) polypeptide F
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC003582
• Gene Symbol: POLR2F
• Gene ID (NCBI): 5435
• RRID: AB_3085220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61218
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.