Tested Applications
| Positive WB detected in | LNCaP cells, NIH/3T3 cells, MCF-7 cells, A549 cells, HeLa cells, 4T1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68511-1-Ig targets POLR2F in WB, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7472 Product name: Recombinant human POLR2F protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-127 aa of BC003582 Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD Predict reactive species |
| Full Name | polymerase (RNA) II (DNA directed) polypeptide F |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC003582 |
| Gene Symbol | POLR2F |
| Gene ID (NCBI) | 5435 |
| RRID | AB_3085220 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P61218 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for POLR2F antibody 68511-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



