• Featured Product
  • KD/KO Validated

POLR3D Monoclonal antibody

POLR3D Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 68263-1-Ig
Clone No.2F5G4

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, FC (Intra), ELISA

RPC4, DNA-directed RNA polymerase III subunit RPC4, DNA-directed RNA polymerase III subunit D, BN51T, BN51

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, rabbit brain tissue, K-562 cells, HEK-293 cells, HeLa cells, Jurkat cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68263-1-Ig targets POLR3D in WB, FC (Intra), ELISA applications and shows reactivity with human, rabbit samples.

Tested Reactivity human, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7646

Product name: Recombinant human POLR3D protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 45-398 aa of BC004484

Sequence: SRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR

Predict reactive species
Full Name polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Calculated Molecular Weight 44 kDa
Observed Molecular Weight44 kDa
GenBank Accession NumberBC004484
Gene Symbol POLR3D
Gene ID (NCBI) 661
RRIDAB_2935348
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05423
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Polymerase (RNA) III (DNA directed) polypeptide D(POLR3D) plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3D can sense non-self dsDNA that serves as template for transcription into dsRNA.

Protocols

Product Specific Protocols
FC protocol for POLR3D antibody 68263-1-IgDownload protocol
WB protocol for POLR3D antibody 68263-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...