POLR3D Monoclonal antibody, PBS Only

• 

  WB analysis using 68263-1-Ig (same clone as 68263-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68263-1-Ig (POLR3D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68263-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit brain using 68263-1-Ig (same clone as 68263-1-PBS)

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 68263-1-Ig (POLR3D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68263-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68263-1-Ig (same clone as 68263-1-PBS)

  WB result of POLR3D antibody (68263-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-POLR3D transfected HEK-293 cells. This data was developed using the same antibody clone with 68263-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 68263-1-Ig (same clone as 68263-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 68263-1-Ig (POLR3D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68263-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 68263-1-Ig (same clone as 68263-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug POLR3D Monoclonal antibody (68263-1-Ig, Clone:2F5G4) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 68263-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

POLR3D Monoclonal Antibody for Indirect ELISA, WB

Cat No. 68263-1-PBS

Clone No.2F5G4

Host / Isotype

Mouse / IgG1

Reactivity

rabbit, human

Applications

Indirect ELISA, WB

Synonyms

RPC4, DNA-directed RNA polymerase III subunit RPC4, DNA-directed RNA polymerase III subunit D, BN51T, BN51

---

Product Information

68263-1-PBS targets POLR3D in Indirect ELISA, WB applications and shows reactivity with rabbit, human samples.

• Tested Reactivity: rabbit, human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7646

  Product name: Recombinant human POLR3D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 45-398 aa of BC004484

  Sequence: SRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR

• Full Name: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC004484
• Gene Symbol: POLR3D
• Gene ID (NCBI): 661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05423
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Polymerase (RNA) III (DNA directed) polypeptide D(POLR3D) plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3D can sense non-self dsDNA that serves as template for transcription into dsRNA.