Tested Applications
| Positive WB detected in | U-87 MG cells, human placenta tissue, mouse cerebellum tissue, mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
27391-1-AP targets PPAP2B in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26422 Product name: Recombinant human PPAP2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC009196 Sequence: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN Predict reactive species |
| Full Name | phosphatidic acid phosphatase type 2B |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 30-40 kDa |
| GenBank Accession Number | BC009196 |
| Gene Symbol | PPAP2B |
| Gene ID (NCBI) | 8613 |
| RRID | AB_3669598 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14495 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Phosphatidic acid phosphatase type 2B (PPAP2B), also known as Lipid phosphate phosphatase 3 (LPP3), is a member of the phosphatidic acid phosphatase (PAP) family. PPAP2B is an integral membrane protein that inactivates lysophosphatidic acid, was implicated in coronary artery disease (CAD) by genomewide association studies (PMID: 26034042). PPAP2B can be detected at least two immunoreactive bands with different mobility, ranging from 36 to 50 kDa, which may reflect oligomer formation and/or post-translational protein modifications, such as glycosylation (PMID: 28364255).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PPAP2B antibody 27391-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

