Tested Applications
Positive WB detected in | mouse skeletal muscle tissue |
Positive IP detected in | mouse skeletal muscle tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
20635-1-AP targets PPAPDC3 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14676 Product name: Recombinant human PPAPDC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC006362 Sequence: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQL Predict reactive species |
Full Name | phosphatidic acid phosphatase type 2 domain containing 3 |
Calculated Molecular Weight | 271 aa, 29 kDa |
Observed Molecular Weight | 29 kDa |
GenBank Accession Number | BC006362 |
Gene Symbol | PPAPDC3 |
Gene ID (NCBI) | 84814 |
RRID | AB_10696180 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NBV4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPAPDC3(Phosphatidic acid phosphatase type 2 domain-containing protein 3) is also named as C9orf67 and belongs to the PA-phosphatase related phosphoesterase family. It plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PPAPDC3 antibody 20635-1-AP | Download protocol |
IP protocol for PPAPDC3 antibody 20635-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Genome Biol Specific nuclear envelope transmembrane proteins can promote the location of chromosomes to and from the nuclear periphery. | ||
Cells Lamin A/C Assembly Defects in LMNA-Congenital Muscular Dystrophy Is Responsible for the Increased Severity of the Disease Compared with Emery-Dreifuss Muscular Dystrophy. | ||
Front Cell Dev Biol Nuclear envelope transmembrane proteins involved in genome organization are misregulated in myotonic dystrophy type 1 muscle |