Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, human heart tissue, rat heart tissue, mouse heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
| CoIP | See 1 publications below |
Product Information
18466-1-AP targets PPIF in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13151 Product name: Recombinant human PPIF-Specific protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-207 aa of BC005020 Sequence: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS Predict reactive species |
| Full Name | peptidylprolyl isomerase F |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 16~22 kDa |
| GenBank Accession Number | BC005020 |
| Gene Symbol | PPIF |
| Gene ID (NCBI) | 10105 |
| RRID | AB_2169273 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30405 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPIF, also named as Cyclophilin D (CypD), CYP3, PPIase F and Rotamase F, belongs to the cyclophilin-type PPIase family. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIF is a mitochondrial matrix protein involved in the induction of necrotic and apoptotic cell death through the activation of the mitochondrial permeability transition (mPT) pore. This antibody is immunized with full length gene PPIF and absorbed by PPIA. So this antibody is specific to PPIF.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPIF antibody 18466-1-AP | Download protocol |
| IHC protocol for PPIF antibody 18466-1-AP | Download protocol |
| IP protocol for PPIF antibody 18466-1-AP | Download protocol |
| WB protocol for PPIF antibody 18466-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun The mitochondrial fusion protein OPA1 is dispensable in the liver and its absence induces mitohormesis to protect liver from drug-induced injury | ||
Aging (Albany NY) Overexpression of TICRR and PPIF confer poor prognosis in endometrial cancer identified by gene co-expression network analysis. | ||
J Biol Chem The short variant of optic atrophy 1 (OPA1) improves cell survival under oxidative stress. | ||
Cell Signal Diminution of HSP75 disrupts intestinal epithelial barrier by inciting mPTP opening in ulcerative colitis | ||
Cells Upregulated Hexokinase-2 in Airway Epithelium Regulates Apoptosis and Drives Inflammation in Asthma via Peptidylprolyl Isomerase F |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Samuel (Verified Customer) (10-29-2025) | After having used an anti-PPIF primary antibody from two competing vendors for Western Blot analyses, both at a dilution of 1:750, I can say with confidence that the Proteintech anti-PPIF antibody works a lot better when taking into consideration the sharpness of the protein bands observed during Western Blot imaging, the relative lack of non-specific binding, and the fact that all of this was achieved at a primary antibody dilution of 1:1000 rather than 1:750, making the product not only higher quality when compared to competitors, but also more cost effective in the long run. I have been able to re-use the same primary antibody solution for four different Western Blot experiments and there is little to no reduction in band quality. I have also used this specific antibody for one IHC experiment, which yielded results that were very much to my liking, primarily as a result of the signal intensity, which I would rate above average compared to competitors. All this being said, I would highly recommend this specific antibody for anyone who is considering using it for great results, at least from a Western Blot and IHC perspective.
|
FH Veronica (Verified Customer) (01-30-2024) | Really satisfied with the result in WB. No aspecific signal, clear band. Reccomended! Conditions: 12% acrylammide gel Ab’: 1:2000 in 5% milk O/N
![]() |






















