Tested Applications
| Positive WB detected in | HepG2 cells, pig brain tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue | 
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | SH-SY5Y cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
67783-1-Ig targets PPP2R2A/B/C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit | 
| Cited Reactivity | human | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag30774 Product name: Recombinant human PPP2R2B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 290-443 aa of BC031790 Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN Predict reactive species | 
                                    
| Full Name | protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform | 
| Calculated Molecular Weight | 443 aa, 52 kDa | 
| Observed Molecular Weight | 52 kDa | 
| GenBank Accession Number | BC031790 | 
| Gene Symbol | PPP2R2B | 
| Gene ID (NCBI) | 5521 | 
| RRID | AB_2918547 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | Q00005 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
The PPP2R2B gene encodes a deduced 443 amino acid protein of approximately 52 kDa, which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing. This antibody can recognize PPP2R2A and PPP2R2C due to the immunogen of PPP2R2B having high homology with PPP2R2A and PPP2R2C.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPP2R2A/B/C antibody 67783-1-Ig | Download protocol | 
| IHC protocol for PPP2R2A/B/C antibody 67783-1-Ig | Download protocol | 
| WB protocol for PPP2R2A/B/C antibody 67783-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 













