PPP2R2A/B/C Monoclonal antibody

PPP2R2A/B/C Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67783-1-Ig
Clone No.2E1D5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

PPP2R2B, PP2A subunit B isoform B55-beta, PP2A PR55B, PP2A B55BETA, B55β

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, pig brain tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse brain tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67783-1-Ig targets PPP2R2A/B/C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30774

Product name: Recombinant human PPP2R2B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 290-443 aa of BC031790

Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN

Predict reactive species
Full Name protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
Calculated Molecular Weight 443 aa, 52 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC031790
Gene Symbol PPP2R2B
Gene ID (NCBI) 5521
RRIDAB_2918547
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ00005
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PPP2R2B gene encodes a deduced 443 amino acid protein of approximately 52 kDa, which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing. This antibody can recognize PPP2R2A and PPP2R2C due to the immunogen of PPP2R2B having high homology with PPP2R2A and PPP2R2C.

Protocols

Product Specific Protocols
WB protocol for PPP2R2A/B/C antibody 67783-1-IgDownload protocol
IHC protocol for PPP2R2A/B/C antibody 67783-1-IgDownload protocol
IF protocol for PPP2R2A/B/C antibody 67783-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

MedComm (2020)

Regulation of XPO5 phosphorylation by PP2A in hepatocellular carcinoma.

Authors - Jiao Li
Loading...
||
New chat Able
正在加载,请稍候...